PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48242.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 231aa    MW: 27061 Da    PI: 5.0741
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48242.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-15855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEde+l   v++lG ++W++ a+  g++R++k+c++rw +yl
       KHN48242.1  8 KGTWLQEEDEQLTSFVARLGERRWDSLAKVAGLKRSGKSCRLRWMNYL 55
                     799*******************************************97 PP

2Myb_DNA-binding54.62.5e-1762106248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g ++ eE++l+v++ ++lG++ W++Iar+++ gRt++++k++w ++l
       KHN48242.1  62 GHFSVEEEQLIVQLQQELGNK-WAKIARKLP-GRTDNEIKNYWKTHL 106
                      6799*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.949355IPR017930Myb domain
SuperFamilySSF466891.48E-275102IPR009057Homeodomain-like
SMARTSM007172.5E-13757IPR001005SANT/Myb domain
PfamPF002491.9E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-20962IPR009057Homeodomain-like
CDDcd001671.53E-81055No hitNo description
PROSITE profilePS5129426.83656110IPR017930Myb domain
SMARTSM007171.4E-1660108IPR001005SANT/Myb domain
PfamPF002491.6E-1562106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2563109IPR009057Homeodomain-like
CDDcd001678.56E-1164106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MQGENLRKGT WLQEEDEQLT SFVARLGERR WDSLAKVAGL KRSGKSCRLR WMNYLRPNLK  60
HGHFSVEEEQ LIVQLQQELG NKWAKIARKL PGRTDNEIKN YWKTHLRKRA QAQQVSGDFK  120
YKLEIATQEV NQKSIDMDSK NCKHGNVWCQ DSEWETKDSS STDTLSLSDW ELRSSPYETR  180
ILDWIAELQN GYGENELEQD CNSTGTCNYY PQEFDEGCDS WDYSGSLWDM N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-2661102105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-25611056159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-25611056159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-25611025128MYB TRANSFORMING PROTEIN
1mse_C9e-2661102105C-Myb DNA-Binding Domain
1msf_C9e-2661102105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541429.11e-158PREDICTED: transcription factor WER-like
TrEMBLA0A0B2SVJ81e-172A0A0B2SVJ8_GLYSO; Transcription factor MYB48
STRINGGLYMA13G20880.21e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-52myb domain protein 27
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]